Watts Premier WP116102 Pureteck standard hjælpehane til RO vandfiltreringssystemer, nikkel

Brand:Watts Premier

3.4/5

kr
635.64

PRODUKTBESKRIVELSE Denne standard omvendt osmose og vandfiltrering ikke-luftspalte vandhane er designet til funktionel lethed og forlænget levetid. Det er ikke-overvåget og vil ikke advare dig, når du skal skifte dine filtre, som en overvåget vandhane vil. Denne vandhane kræver adgang til en afløbsforbindelse og har et Touch 'N Flow fjederbelastet håndtag til one-touch-vanddispensering. Denne standard-hjælpehane til vandfiltreringsenheder opfylder VVS-koder for omvendt osmose-enheder og opfylder alle NSF-krav med lavt blyindhold. FRA PRODUCENTEN Standard hjælpehane til vandfiltreringsenheder. Touch 'N Flow fjederbelastet håndtag til one-touch-vanddispensering. Vandhaner er designet til funktionel lethed og forlænget levetid.

Opfylder alle amerikanske VVS-koder og NSF lave blykrav. Bruger 1/4" forsyningsrør og kræver adgang til en afløbsforbindelse. Det er en ikke-luftgab, ikke-overvåget vandhane og vil ikke advare dig, når det er tid til at skifte filter. Funktioner Touch N' Flow fjederbelastet håndtag til one-touch-vanddispensering. Dette er en standard hjælpehane, og den er kompatibel med omvendt osmose under vaskevandsfiltreringssystemer.
Batteries Included? ‎No
Batteries Required? ‎No
Brand Watts Premier
Brand ‎Watts Premier
Capacity 8 Cubic Centimeters
Capacity ‎8 Cubic Centimeters
Color Nickel
Color ‎Nickel
Customer Reviews 4.3 4.3 out of 5 stars 728 ratings 4.3 out of 5 stars
Finish ‎Brushed Nickel Finish
Included Components Faucet
Included Components ‎Faucet
Installation Method Single Hole
Installation Method ‎Single Hole
Is Discontinued By Manufacturer ‎No
Item model number ‎WP116102
Item Package Quantity ‎1
Item Weight ‎0.64 Pounds
Item Weight ‎10.2 ounces
Manufacturer ‎Watts
Material Alloy Steel
Material ‎Alloy Steel
Model Name ‎Pureteck Standard
Mounting Type ‎Deck Mount
Number of Handles ‎1
Package Information Dispenser
Package Information ‎Dispenser
Part Number ‎116102
Power Source ‎Filtration
Product Dimensions 1.5"L x 3.75"W x 11.5"H
Product Dimensions ‎1.5"L x 3.75"W x 11.5"H
Product Dimensions ‎3.75 x 1.5 x 11.5 inches
Purification Method Reverse Osmosis
Purification Method ‎Reverse Osmosis
Special Feature Modern sleelk design for optimal and smooth water output
Special Feature ‎Modern sleelk design for optimal and smooth water output
Special Features ‎Modern sleelk design for optimal and smooth water output
Warranty Description ‎1 year

3.4

11 Review
5 Star
66
4 Star
16
3 Star
8
2 Star
4
1 Star
7

Skriv din anmeldelse

Din e-mail vil ikke blive offentliggjort. Alle obligatoriske felter er markeret med*

Scritto da: Mary F.
BEST we've found!
We live full time in a 5th wheel, 10 yrs ago we bought a used 5th & previous owners had installed this. Where we lived the water was nasty, so we bought the filters and it worked so well that others in our park also bought WATTS PREMIER system! Fast forward...we moved & bought a brand new 5th wheel and the very 1st thing we did is bought the VERY SAME system! We have city water, but this system removes so much that our water tastes CLEAN! Even our Grandkids actually asks for a glass of water instead of soda!!! If that isn't an awesome testimony coming from a 5 & 7 yr old, I don't know is! Don't hesitate, it will benefit your health and cooking :)
Scritto da: Emelia Durr
Very good replacement faucet.
Scritto da: Frankie
Decent product for the price
Can't beat the price (not at local stores, that's for sure) and is much better built than filter mfrs. (Culligan) similar faucet seen at local stores. My faucet did NOT drip at all after I installed it. The only problem I had was trying to connect it to a 3M water filterFiltrete 3M Filtrete Water Station which had larger tubing connectors. It took 2 visits to 2 hardware stores to find an adapter...so I now have larger 1/4? (?) tubing (provided by 3M with the filter) coming from the filter, then a brass adapter with 2 compression fittings at each end, leading to smaller 1/8 (?) tubing (from hardware store) and a final compression fitting (hardware store) at the base of this faucet. All leak free after 48 hours but the extra connections make me a little nervous. It is also a bit alarming how easily you can pull the dispensing tube right out of the faucet (I did accidentally during installation), there are only 3 rubber o-rings holding it in place and a small yank will pull it right out. However, the faucet handle is what controls water dispensing so even if the dispensing tube was pulled out somehow, it will not start spraying water all over (I checked!) Push down black handle to dispense water temporarily (it'll spring back up). Pull up and release black handle to dispense constantly. I guess given my sort of non-standard installation with the filter (which is my problem) and the excellent price, I have to give it 4 stars but am keeping an eye on it!
Scritto da: Online shopper
Replaced a chrome faucet
I have a wonderful RO system, but they installed a chrome faucet, and everything else I have is black. So, when it was time to replace my sink faucet, I shopped for a black RO faucet too. NOTHING at Home Depot or any of the other home repair stores in black. Found this here on Amazon. There was a "air gap faucet" and a "non air gap faucet". Now what's the difference? I have no idea! I called my plumber, he said all I needed was a 1/4 inch line that went to the faucet. It's odd because when I spoke to the plumbing supply, they told me I needed a "special" RO replacement faucet that cost $200.00. Really?? So I went without replacing it for a long time. I bought this one instead of the more expensive air gap one since my plumber only said I needed a 1/4 inch line. He installed it, and it couldn't be nicer. Works perfect. So, if you want to replace a RO faucet, this is the one!!! No need for a $200.00 faucet. I didn't have any of the problems I read about on other reviews since I would never mess around fixing my own plumbing. I hire a plumber!! My sanity is more important than the few dollars the plumber charges since he was doing other things at the same time. It is a gloss finish, not matt. I couldn't find that anywhere in the description.
Scritto da: JB
Happy Happy
1'm using one of these instead of the one that came with my new Culligan EZ-4 water filter system at home, and I've found that the Watts (116102 standard faucet) faucet is a lot better than the cheaply made one that Culligan provided. This Watts faucet model doesn't drip after usage either! It was a pleasant surprise to see that the Watts 116102 faucet has a continual "ON" running position too! Whether your using this faucet to replace an old one, or upgrade it from the one you have ... The quality you get at its iow price ... ... you won't be disappointed! It also blends in well above your sink :) You should onsider purchasing this faucet to replace the one that came with the Culligan EZ-4 water filter system. You'll be "Glad" you did! Easy to Install! * Reliable - Durable - Cost Effective * Note: EZ- 4 Culligan Filtration System. You'll loose the feature of a light telling you it's time to replace your filter, but just know that the manufacture recommends times they should be changed and taste is another way to determine if its change filature time. So loosing this feature shouldn't deter you away from getting it. Enjoy!
Scritto da: Agent86ish
I don't like the spring loaded lever
I'm not crazy about this faucet, but it does work well. The other reviewers are correct. I had to make a trip to the hardware store to get this to work with the Culligan water filtration system that we purchased at the same time. Installation was relatively easy - I have basic homeowner skills. Instructions were lacking. There just wasn't much there. Fortunately, the Water Filtration system had instructions that seemed to cover the issue. What I don't like: The unit comes with an ill-fitting rubber gasket that goes between the faucet and the sink. At least I think that is where it goes - I couldn't tell from the instructions. It doesn't look professional. You are required to make it fit. There is no guide that helps you to center the gasket. I got mine a little off, so is doesn't look exactly right. I also don't like the lever. I'd prefer to move the lever and have it stay in the 'on' position until my glass is full. This one is spring loaded - meaning that you have to hold the lever down to get the water to flow. Call me lazy, but I don't like to hold the lever. What I do like: It works. It looks like the other faucet that my wife bought. It doesn't leak. I would not have bought this faucet had I known about the lever. On the other hand, I am not going to change it now that the project is done. Kind of a wishy washy review here. Sorry.
Scritto da: Paul Boivin
Nice unit
Works great and easy to get all set up. It is a little shinier then our faucet but it's nicer then the plastic one it replaced. To bad I could find a putter or brushed silver one at that price. Still looks good works great
Scritto da: Amazon Customer
Great value
Like others have mentioned, it certainly isn’t the most luxurious water faucet out there. However super easy to install and has been working flawlessly for the last couple weeks.
Scritto da: madaboutbrittanys
Simple - it works!
I bought two of these from my plumbing wholesaler as our friends spout developed a leak. Both units from the wholesaler leaked at the handle. I wasn't happy. I made them remove every one of them from the shelf and they got in touch with their supplier as obviously there was an issue with manufacturing. I purchased the Watt's one here and zero issues upon installing. I should have ordered it from Amazon in the first place! Oh well. Lesson learned. It works great.
Scritto da: A.H
Great product
Really happy with this! It came really quickly and has worked great!
Scritto da: Zachamo
Seems to be working fine
I installed this about 4 months ago and it's been working fine, but it seems a little more wobbly than I'd like and makes me a tad nervous.. Some folks mentioned oily residue coming out with their water and I did notice a SLIGHT bit of this in the beginning, but just ran a bunch of water through this and it seems to have improved. Looks fine and otherwise easy to install.

Relaterede produkter

Oplev vores internationale netværk

Vi sender til 28 lande, over 200.000 produkter. Hold dig opdateret, tilmeld dig nyhedsbrevet.

Array